About Products Protein Database Contact

Protein expression services for epmA | Elongation factor P--(R)-beta-lysine ligase

Description
With EpmB is involved in the beta-lysylation step of the post-translational modification of translation elongation factor P (EF-P). Catalyzes the ATP-dependent activation of (R)-beta-lysine produced by EpmB, forming a lysyl-adenylate, from which the beta-lysyl moiety is then transferred to the epsilon-amino group of a conserved specific lysine residue in EF-P.
Family
Belongs to the class-II aminoacyl-tRNA synthetase family. EpmA subfamily.
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Length
325 amino acids
Sequence
MSETATWQPSAPIPNLLKRAAVMAEIRRFFTDRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGLNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPCYDMYRLINEVDDLLQQVLECQPAESLSYQQAFQRHLEIDPLSADKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKDRPTFIYHFPATQASLAQISPEDHRVAERFEVYYKGIELANGFHELTDAHEQRLRFEQDNRKRAARGLPQQPIDNNLLAALEAGLPDCSGVALGVDRVVMLALGAESIGEVIAFTVDRA
Mass
36.8 kDa
Simulated SDS-PAGE
Western blot of epmA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make epmA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here