An exported protein. Unlike its M.tuberculosis counterpart has poor pore forming ability in artificial liposomes, does not undergo conformational change at acidic pH (PubMed:23150662). Mutation of 2 residues to those found in M.tuberculosis (25-TA-26 to IH) alters the properties of this protein so that it inserts into liposomes at acidic pH, forming pores, like its M.tuberculosis counterpart (PubMed:26801203).

Belongs to the WXG100 family. ESAT-6 subfamily.

95 amino acids

MTEQVWNFAGIEGGASEIHGAVSTTAGLLDEGKASLTTLASAWGGTGSEAYQAVQARWDSTSNELNLALQNLAQTISEAGQTMAQTEAGVTGMFA

9.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make esxA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here