Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture (PubMed:22474391). Redundantly involved with EPFL4 in procambial development regulation. Acts also as tissue-specific regulator of epidermal pattern. Controls stomatal patterning by repressing stomatal production. TMM (AC Q9SSD1) functions to dampen or block CHAL signaling. Not processed by SDD1 (AC O64495). Acts as growth-regulatory ligand for ERECTA family receptors.

Belongs to the plant cysteine rich small secretory peptide family. Epidermal patterning factor subfamily.

156 amino acids

MGFERTSSSLSLLSSSLPSSLQPSENTRAKFSLFYLLLLFFVLCVIATFTITPTSTSSPYNRNSNSGTLGNFYAKEEGKSTVVIKKTRKIGDRSKEAELRRILRGLGSSPPRCSSKCGRCTPCKPVHVPVPPGTPVTAEYYPEAWRCKCGNKLYMP

17.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EPFL6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here