Controls stomatal patterning. Mediates differentiation of stomatal lineage cells to pavement cells and stomatal development inhibition (PubMed:23748792). TMM (AC Q9SSD1) functions to dampen or block CLL1 signaling. Acts as growth-regulatory ligand for ERECTA family receptors. Promotes fruit growth and fertility (PubMed:22474391).

Belongs to the plant cysteine rich small secretory peptide family. Epidermal patterning factor subfamily.

107 amino acids

MGVVLPTLIVYAFLLFFSSSSAASLQRPSGGLGQGKKEIARSGLPGQIVDQKRLGGPGSVPPMCRLKCGKCEPCKAVHVPIQPGLIMPLEYYPEAWRCKCGNKLFMP

11.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EPFL5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here