Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture (PubMed:22474391). Redundantly involved with EPFL6 in procambial development regulation. Controls stomatal patterning. Mediates stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL2 signaling. Acts as growth-regulatory ligand for ERECTA family receptors.

Belongs to the plant cysteine rich small secretory peptide family. Epidermal patterning factor subfamily.

109 amino acids

MGTFRRRRRFLLAALVTFALLHLFSASSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP

12.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EPFL4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here