Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor (YhdL) until released (PubMed:14993308). This sigma factor is involved in the maintenance of membrane and cell wall integrity in response to environmental stresses including salt, acid, ethanol and antibiotics stress (PubMed:22211522, PubMed:12775685). Partially regulates transcription from a number of genes including disA (PubMed:17434969).

Belongs to the sigma-70 factor family. ECF subfamily.

163 amino acids

MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDLIGSLFQNAVQSPAHQVEIKEVLTGYMSELPDNYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLKALYNRGVNDE

19.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sigM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here