Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor (NrsF in this case) until they are released (Probable). Up-regulates expression of 4 operons (sigF-nrsF, CCNA_02834, CCNA_03001 to CCNA_02999 and CCNA_03363 to CCNA_03366) in response to potassium dichromate (K(2)Cr(2)O(7)) or cadmium chloride (CdCl(2)) (PubMed:22985357). Overexpression of sigF leads to higher expression of its regulon (PubMed:22985357).

Belongs to the sigma-70 factor family. ECF subfamily.

179 amino acids

MTDTETRLKALMLRGLDGDTAAYREGLALLGVRLRAYFMRRMSGAPGDVEDLVQETLLAVHLKRSTWDSAQSFTAWAHAVARYKLIDHWRRRKIRQTLPLEDHVDFLADDAPDPGVALELDRALASLPQRQRMLVSDVKLTGLSLAEAGARAGISEGAAKVALHRALKALAERMRRADG

19.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sigF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here