About Products Protein Database Contact

Protein expression services for sina | E3 ubiquitin-protein ligase sina

Description
E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk). E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons. Also involved in external sensory organ development.
Family
Belongs to the SINA (Seven in absentia) family.
Species
Drosophila willistoni
Length
331 amino acids
Sequence
MSNKINPKRREPTAAAAAAVAAGVGGGVGGGASGVATANTNTTGSSSTGGSSSAGTTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV
Mass
35 kDa
Simulated SDS-PAGE
Western blot of sina recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make sina using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here