E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates the ubiquitin-mediated degradation of nuclear receptors for retinoids SmRXR1 and SmRXR2.

Belongs to the SINA (Seven in absentia) family.

371 amino acids

MNNSITEVNMSVPSRATNSNNTILSEERTCHRSQMASSDAVGRTMALLPINHNHALHHGIKLMPHINMPHREVGATTPLVTNSGTASTCSMSLPGSMSSASDTVCNILPHNTSDSSSIDLASLFECPVCMDYALPPIMQCQSGHIVCASCRSKLSSCPTCRGNLDNIRNLAMEKLASSVLFPCKYSTSGCPETFHYTSKSEHEAACEYRPYDCPCPGASCKWLGELEQVMPHLVHHHKSITTLQGEDIVFLATDISLPGAVDWVMMQSCFGHSFMLVLEKQERVPDQIFFALVQLIGTRKQADQFVYRLELNGHRRRLTWEACPRSIHDGVQSAIAVSDCLVFDSNTAHSFAENGNLGINVTISQVSPSIS

40.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SINA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here