Description
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in eye morphogenesis, probably triggers the ubiquitin-mediated degradation of different substrates (PubMed:11335112). May play a role in the regulation of the cellular clock function (By similarity).
Family
Belongs to the SINA (Seven in absentia) family.
Sequence
MSRPSSAGPCASKPCGKQKQPPPPPPHAPSLPATISGGPGASAPPAPTAAAITGPLSQQHQELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRASLTPSIRNLAMEKVASAVLFPCKYASTGCSLSLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLENVMQHLTHSHKSITTLQGEDIVFLATDINLPGAVDWVMMQYCFNHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENYAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service