Probable ubiquitin-protein ligase involved in the degradation-related ubiquitination of histones. Contributes to the post-translational regulation of histone protein levels by polyubiquitination of excess histones for subsequent degradation.

Belongs to the RBR family.

504 amino acids

MSDLLDDEFYEEEFENDLLDASEFEDEFDEDAEIDDDGFTVERKRRRAHSVSYRVVSVRDLRASLNEKINQLTSIIDLTREQVLGLYRYFKWNRERLLERYIDAPEESLQKAGVGLSGSKQREVVHHEGTCEICYDEGCLPFFSAECDHEFCLACYRQYLDSRISEGESVIQCPEESCTQIVSIQSITKVLDEKSLDRYHRLLDRSFVDDNDHLRWCPAPDCEFAIECHVTQASLSSVVPTVTCNCGKQFCFGCGHDNHQPTICPLVKIWLQKCQDDSETANWIHANTKECPKCSTTIEKNGGCNHMTCKKCKYEFCWVCLGPWTEHGNNWYTCNRYEEKSSTSARDSQSKSRASLERYLHYYNRFANHEQSAKLDHELYEHTHKRMTQMQVDSNLSWVEVQFLKNAVDILFQCRQTLKWTYAFAYYLARNNQTEIFEDNQRDLELAVENLSELCERPCQDCSLSVFKQRVLDKTVYVRSRRDVLLDDTARGLAEGRWEYVVDV

58.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dbl4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here