E3 ubiquitin-protein ligase involved in ER-associated protein degradation, preferentially associates with the E2 enzyme UBE2J2. Exploited by viral US11 proteins to mediate HLA class I proteins degradation.

Belongs to the TMEM129 family.

362 amino acids

MDSPEVTFTLAYLVFAVCFVFTPTEFHSAGLTVQNLLSGWLGSEDAAFVPYHLRRTAATLLCHSLLPLGYYVGMCFAASEKQLYYPSQTPETWRAFLLLALMLPAIACTLIYYWSRDHWACHPLARTLALYALPRSGWQAVASSVNTEFRRIDKFATGVPGARVIVTDTWVMKVTTYRVHVAQQQDVRLTVTEAQQHELSPDSHLPVQLLTIRVASANPAVPAFHIRLNSTEYGELCEKLRAPIRSAANVVIHQSLGDLFLETFASLVEVNPAYSVPSSQDLEACIGCMQTQASVKLVKTCQEVAVGECQQCYCRPMWCLTCMGKWFASRQDPQRPDTWLASRVPCPTCRARFCVLDVCAVR

40.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TMEM129 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here