Protein expression services for At1g66650 | E3 ubiquitin-protein ligase SINA-like 4
Description
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates.
Family
Belongs to the SINA (Seven in absentia) family.
Species
Arabidopsis thaliana
Length
329 amino acids
Sequence
MTKLGRRNDGGGKSHRSSTKRQRRTSVSVDDPSPGEEEEKTLVVLTDDSDSEEDDKPLGDVLRTCRKRRVSSPKSVTLPNSNVLECPNCFDPLKKPIFQCNNGHLACFLCCIKLKKRCSFCKLPIGDVRCRAMEKVIKAGLVSCSNAIYGCKQSTTYGNQLQSHEKVCVFAPCSCPIKDCNYIGFYKDLINHFRATHKVSPGDINSFVFDRPVIFGLDLDSSDKMVIFVEEKQGNLFVVQGFIGSHGVYATVSHIAPMVPEVRKFSCSLARLRPYSTLRLGLEVKNIQKLRSQEEQPQEDFLLIPSYMVNGDHMKMEISIGDKNDYTHI
Mass
36.9 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make At1g66650 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here