E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates (Probable). Mediates the proteasomal-dependent degradation of ATG6, a component of the autophagosome complex. Requires TRAF1A/MUSE14 and TRAF1B/MUSE13 to target ATG6 for ubiquitination and subsequent regulation of autophagosome assembly (PubMed:28351989).

Belongs to the SINA (Seven in absentia) family.

308 amino acids

MAPGGSALKEVMESNSTGMDYEVKTAKVEVNNNKPTKPGSAGIGKYGIHSNNGVYELLECPVCTNLMYPPIHQCPNGHTLCSNCKLRVQNTCPTCRYELGNIRCLALEKVAESLEVPCRYQNLGCHDIFPYYSKLKHEQHCRFRPYTCPYAGSECSVTGDIPTLVVHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMGDENEAKKFSYSLEVGAHGRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFSGGDRQELKLRVTGRIWKEE

35 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SINAT2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here