Description
Acts as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Triggers apoptosis in response to prolonged ER stress by mediating the polyubiquitination and subsequent proteasomal degradation of BCL2L1. May collaborate with FATE1 to restrain BIK protein levels thus regulating apoptotic signaling.
Sequence
MAEQQGREPECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHISLVTPTRRRLLCPLCRHPTVLASGQPVTDLPTDTAVLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGPEPASQAGQPQDVGPSTRPVPIRSRYSLRECFRNPHFRIFAYMMAVILCGTVLFIFSIFCTRRFFWGVG
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service