E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-118' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-118' ubiquitination gives a specific tag for epigenetic transcriptional repression. Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. PcG complexes act via modification of histones, such as methylation, deacetylation, ubiquitination rendering chromatin heritably changed in its expressibility. May play a role in meiotic sister chromatid cohesion.

435 amino acids

MTSLDPAPNKTWELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQEKVMAKFNQTQSQQALVNSINEGIKLQSQNRPQRFRTKGGGGGGGGGGNGNGAANVAAPPAPGAPTAVGRNASNQMHVHDTASNDSNSNTNSIDRENRDPGHSGTSAASAITSASNAAPSSSANSGASTSATRMQVDDASNPPSVRSTPSPVPSNSSSSKPKRAMSVLTSERSEESESDSQMDCRTEGDSNIDTEGEGNGELGINDEIELVFKPHPTEMSADNQLIRALKENCVRYIKTTANATVDHLSKYLAMRLTLDLGADLPEACRVLNFCIYVAPQPQQLVILNGNQTLHQVNDKFWKVNKPMEMYYSWKKT

47.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Sce using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here