Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity).

Belongs to the dynein light chain LC1-type family.

192 amino acids

MAKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPLEKMDASLSTLVNCEKLSLSTNCIEKIANLNGLKYLKILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWAEFSKLGELPLLGDIVFVGNPLEEKHTAEGNWMEEAVKRLPKLKKLDGNPVIKQEEEEGDES

21.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dnal1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here