May play a role in regulating dynein heavy chain (DHC) activity. May function in holding IC78 to the DHC, or in stabilizing the entire dynein complex.

Belongs to the dynein intermediate chain family.

567 amino acids

MEIYHQYIKLRKQFGRFPKFGDEGSEMLADIRPNEDHGKEYIPRNPVTTVTQCVPEMSEHEANTNAVILVNKAMSHVEGGWPKDVDYTEAEHTIRYRKKVEKDEDYIRTVVQLGSSVEDLIKQNNAVDIYQEYFTNVTMDHTSEAPHVKTVTVFKDPNNIKRSASYVNWHPDGSVPKVVVAYSILQFQQQPAGMPLSSYIWDVNNPNTPEYEMVPTSQICCAKFNLKDNNLVGAGQYNGQLAYFDVRKGNGPVEATPIDISHRDPIYDFAWLQSKTGTECMTVSTDGNVLWWDLRKMNECVENMPLKEKNSETTVGGVCLEYDTNAGPTNFMVGTEQGQIFSCNRKAKNPVDRVKYVLSGHHGPIYGLRRNPFNSKYFLSIGDWTARVWVEDTAVKTPILTTKYHPTYLTGGTWSPSRPGVFFTIKMDGAMDVWDLYYKHNEPTLTVQVSDLALTAFAVQESGGTVAVGTSDGCTSVLQLSTGLSEASPAEKANINAMFERETTREKNLEKAIKEAKVKARKEQGRRDEVKDNVTEEQLKALEDEFFKTTDPAVGGGYGAGEGAAAE

63.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ODA6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here