Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Prevents biotic and abiotic stress responses, including ozone, oxidative stress and pathogen attacks; represses MAPK activities during hypersensitive response to limit the spread of the HR response after infection by necrotrophic pathogen such as Botrytis cinerea. May be also involved in ABA and salt responses. Dephosphorylates MPK3 and MPK6.

Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.

167 amino acids

MEKVVDLFGVGEANSQKLLEGGKDLSEIQQGLFIGSVAEANNKDFLKSSNITHVLTVAVALAPPYPDDFVYKVIEVVDRSETDLTVYFDECYSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAYLMKKHGMGFSKAMELVRSRRHQAYPNPGFISQLQQFEKSIQGNA

18.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DSPTP1B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here