Functions in the let-60 Ras signaling pathway; acts downstream of lin-45 raf kinase, but before the sur-1/mpk-1 gene product in controlling vulval cell differentiation (PubMed:7729690). Required for progression of developing oocytes through the pachytene stage (PubMed:19826475). Plays a role in responses to M.nematophilum-mediated bacterial infection by promoting tail swelling and preventing constipation (PubMed:15268855). Involved in fluid homeostasis (PubMed:11689700). Positively regulates lifespan upstream of mpk-1 (PubMed:20624915).

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

387 amino acids

MSSGKRRNPLGLSLPPTVNEQSESGEATAEEATATVPLEEQLKKLGLTEPQTQRLSEFLQVKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKELAVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVRGLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERLTGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHPPSNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTADVFFTQYADHDDQGEFAVFVKGTINLPKLNP

42.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mek-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here