Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Phosphorylation by MAP2K6 asymmetrically activates p38 on one side of the blastodisc, an event which is necessary for blastomere cleavage.

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

361 amino acids

MEGGSDKESKVFCDSPSPNPKGEMSVPSNVRGKKKLPKELKLPKEVFEKPAPAPTPPRDLDSKAYVTIGEKNFVVKADDLEQIGELGRGAYGVVDKMRHVPSGVIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVHEKGKTIPEDILGKITVSIVKALEHLHSNLSVIHRDVKPSNVLINMQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADRFSADFVDFTSQCLRKNSTERPTYTELMQHPFFTLHDSKDTDVASFVKTILGD

40.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make map2k6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here