Catalyzes the NAD-dependent reversible oxidation of D-threitol. Involved in the degradation pathway of D-threitol, that allows M.smegmatis to grow on this compound as the sole carbon source. Does not catalyze the oxidation of xylitol, L-sorbitol, and L-sorbose.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

260 amino acids

MTQAQELSVDFDFRLDGKVALVTGAASGIGAAIASAYATKGARIAAVDLNAEGAEALAAQLGGDRGAHRGFACDVADAASVQAAADAVAAEFGRIDILVNSAGVARLAPAEELSLQDWDSTLAINLSGTFLMCQAVGKRMLEAGGGAIVNMASQAATVALDQHVAYCASKFGVVGVSKVLAAEWGGRGVRVNTISPTVVLTELGHKAWDGPRGDALKKLIPTGRFAYPDEIAAAAVFLASDAAAMINGADLVIDGGYTIK

26.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dthD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here