About Products Protein Database Contact

Protein expression services for gatZ | D-tagatose-1,6-bisphosphate aldolase subunit GatZ

Description
Component of the tagatose-1,6-bisphosphate aldolase GatYZ that is required for full activity and stability of the Y subunit. Could have a chaperone-like function for the proper and stable folding of GatY. When expressed alone, GatZ does not show any aldolase activity. Is involved in the catabolism of galactitol.
Family
Belongs to the GatZ/KbaZ family. GatZ subfamily.
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Length
420 amino acids
Sequence
MKTLIARHKAGEHIGICSVCSAHPLVIEAALAFDRNSTRKVLIEATSNQVNQFGGYTGMTPADFREFVFAIADKVGFARERIILGGDHLGPNCWQQENADAAMEKSVELVKAYVRAGFSKIHLDASMSCADDSIPLAPETVAERAAVLCLAAESVATDCQREQLNYVIGTEVPVPGGEASAIQSVHITQVEDAANTLRTHQKAFIARGLAEALTRVIAIVVQPGVEFDHSNIIHYQAQXAQALAQWIEKTKMVYEAHSTDYQTQXAYRELVRDHFAILKVGPALTFALREAIFALAQIEQELIAPENRSRCLAVIEEVMLDEPQYWKKYYRTGFNDSLLDIRYSLSDRIRYYWPHSRIKNSVETMMVNLEGVDIPLGMISQYLPKQFERIQSGELSAIPHQLIMDKIYDVLRAYRYGCAE
Mass
47 kDa
Simulated SDS-PAGE
Western blot of gatZ recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make gatZ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here