Catalytic subunit of the tagatose-1,6-bisphosphate aldolase GatYZ, which catalyzes the reversible aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P) to produce tagatose 1,6-bisphosphate (TBP). Requires GatZ subunit for full activity and stability. Is involved in the catabolism of galactitol.

Belongs to the class II fructose-bisphosphate aldolase family. TagBP aldolase GatY subfamily.

284 amino acids

MFIISGRTMLKKAQQEGYAVPAFNIHNLETLQVVVETAAELRSPLIVAGTPGTFSYAGVGNIVAIAAELAKSWNHPLAVHLDHHEKLADIKMKVAAGVRSVMIDGSHFPFADNIALVKSVVDYCHRYDVSVEAELGRLGGQEDDLIVDGKDALYTHPEQAREFVEKTGIDSLAIAIGTAHGLYTAEPKLDFERLTEIRQRVDVPLVLHGASGLPTRDITRAISLGICKVNVATELKIAFSGALKNYLTQHAEASDPRHYMIPAKAAMKEVVRKVIADCGCDGKL

30.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gatY using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here