DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK1 appears to be a negative regulator of the insulin signaling pathway. Modulates integrin activation by competing with talin for the same binding site on ITGB3 (By similarity).

Belongs to the DOK family. Type A subfamily.

482 amino acids

MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSRGGRGGSRRLDCKMIRLAECVSVVPVTVESPPEPGAVAFRLDTAQRSHLLAADAVSSTAWVQTLCRTAFPKGGWALAQTENQPKFSALEMLENSLYSPTWEGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGKVGQAQDILRTDSHDGETEGKTVPPPVPQDPLGSPPALYAEPLDSLRIPPGPSQDSVYSDPLGSTPAGAGEGVHSKKPLYWDLYGHVQQQLLKTKLTDSKEDPIYDEPEGLAPAPPRGLYDLPQEPRDAWWCQARLKEEGYELPYNPATDDYAVPPPRSPKPAPAPKPQGLILPESGTTRGSGSKGFSSDTALYSQVQKSGTSGAWDCGLSKVGNDRAGVKSEGST

52.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Dok1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here