The antenna complex functions as a light receptor, it captures and delivers excitation energy to photosystems II and I. The Prochlorales pcb genes are not related to higher plant LHCs.

Belongs to the PsbB/PsbC family. IsiA/Pcb subfamily.

361 amino acids

MQTYGNPEVTYGWWAGNSVVTNRSGRFIASHVGHTGLICFAAGGSTLWELARYNPEIPMGHQSSLFLAHLASIGIGFDEAGAWTGVGVATIAIVHLILSMVYGGGGLLHGILFDENVEDSEVLQAKKFKLEWNNPDNQTFILGHHLIFMGVACAWFVEWARIHGIYDPALGAIRQVNYNLDLSMIWQRQFDFITIDSLEDVMGGHAFLAFAEITGGAFHIVAGSTPWEDKKLGEWSKFKGSELLSAEAVLSWSLAGIGWMAIVAAFWCASNTTVYPEAWYGEPLQFKFAISPYWVDTGDLSDATAFWGHSARAALTNVHYYLGFFFLQGHFWHALRALGFNFKNVTASIGNEQKATFTIKS

39.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pcbD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here