Cis-prenyl transferase involved in the synthesis of dolichol, a long-chain polyprenol that is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Catalyzes the sequential condensation of isopentenyl pyrophosphate (IPP) with farnesyl pyrophosphate (FPP) to produce a polyprenyl pyrophosphate which contains 11 (major) and 12 (minor) isoprene units.

Belongs to the UPP synthase family.

265 amino acids

MIPMHVAVIMDGNGRWARKQLQERTFGHEQGVSVLESIVDECINCGIRFLTVYAFSTENWSRPPTEVSFLFELLSAAIQRVRTTYRERNVKVQFCGERTTQIPETVIAAMNCIEQDTAACTGLILSVCFNYGGHTEIAQACRSVLADCLEGDAVENIKTRLQMPIEQFIQQIDTHLYANLPPVDLLIRTGCEKRLSNFLPWHLAYAEIIFSDLLWPEFSVRAFKDCLDEFASRTRRFGGVQLSPMTGVYSDTHPHSSTNALSNHD

30 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make UPPS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here