Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.

Belongs to the plant dirigent protein family.

184 amino acids

MANQIYLFSLICLSVLLCQSYTVSSFQKSLDLAKPCKRFVLHLHDIAYDGDNAANATSAAIVNPLGLGDFSFGKFVIMDDPVTMDQNYLSKPVARVQGFFCYHGKATYDAWIAWTVVFNSTQHKGAFTIMGENPFMEPTRDLPIVGGTGDFIMTRGIATLTTDHIDGSKYFRVKLDIKLYECYH

20.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DIR14 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here