Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2 (By similarity).

Belongs to the DPH4 family.

175 amino acids

MTVKSKSRISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSNDQLRAAYNRALNDSNKLAGFNNFGDGLDEFNLDEFEFNEEKLEYVMTCPRCQSGGGFVLSEDMLEECIEDGLTESEEQGYQVLTQCTACSLWLKVNFFINDEEE

19.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DPH4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here