Performs the first committed step in the biosynthesis of isoprene-containing compounds such as sterols and terpenoids (By similarity). Component of the triterpene saponins (e.g. ginsenosides or panaxosides) and phytosterols biosynthetic pathways (PubMed:29378087). Catalyzes the conversion of mevalonate diphosphate to isopentenyl diphosphate (IPP) (PubMed:29509695).

Belongs to the diphosphomevalonate decarboxylase family.

417 amino acids

MAESWVIMVTAQTPINIAVIKYWGKRDETLILPINDSIRVSLDPDHLCTTTTVSVRPSFEQDRMWLNGKEISLLGGRFQSCLREIRSRARDLEDEKKGIVIKKMDWEKLHFHIASYNNFPTAAGLASSAAGLACFVFALAKLLTLQEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEENGSDSIAVQLADEKHWDDLVIVIAVVSARQKETSSTTGMQDSCKTSMLIQHRAKEVVPKRILQMEDAIEKRDFPSFARLACADSNQFHAVCLDTSPPIFYINDTSHKIISCVEKWNRSVGTPQVAYTFDAGPNAVLIARDRKIAALLLRRLLFHFPPHSNTDSNSYVIGDKSILQDVGVQDTKDIESLPPPPEIKDNIPAQKSNGDVSYFICTRPGRGPVLLPDSRALLNPETGLPK

46.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MVD1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here