Catalyzes the transfer of a N-acetyl-glucosamine moiety to 1D-myo-inositol 3-phosphate to produce 1D-myo-inositol 2-acetamido-2-deoxy-glucopyranoside 3-phosphate in the mycothiol biosynthesis pathway.

Belongs to the glycosyltransferase group 1 family. MshA subfamily.

450 amino acids

MAARRRPRSAVPRRVATLSVHTSPLDQPGAGDAGGMNVYVVEVSRRLAERGIAVDVFTRAVSSDLPPVVEMSPGVTVRHVSAGPFEGLGKEELPAQLCAFTAAVLREEAQHEPGHYDVVHSHYWLSGQVGWLARDRWSVPLIHTAHTLAKVKNAALAVGDRPEPRARVIGEEQVVAEADRLVANTADEARQLVDHYGADPRRTLVVPPGVDLDRFTPGDRTAARRRLGVAEDAVVLLFVGRIQPLKAPDLLLEAAARMLADDPALRDRLQVHVVGAPSGTGLEAPRQLEQLAAGLGIADLLRFLPPVHVELLAEHYRAADVAVVPSHNESFGLVALEAQACGTPVVAAAVGGLRTAVRDGVSGVLVEGRDPADYAAAIRAVLARRELLSAGARRHAGAFSWERTVDSLVAAYTAAAEEMAAASQRAVPGTLLRPAWALGGVRALGAQVAR

47.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mshA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here