Description
Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds. Plays an important role in the metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite. TMA is generated by the action of gut microbiota using dietary precursors such as choline, choline containing compounds, betaine or L-carnitine. By regulating TMAO concentration, FMO3 directly impacts both platelet responsiveness and rate of thrombus formation.
Family
Belongs to the FMO family.
Sequence
MVKKVAIIGAGISGLASIRNCLEEGLEPTCFEKGEDIGGLWKFSDHVEEGRASIYRSVFTNSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSSVNKRPDFQTTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNIPKESFPGIKLFKGKCFHSRDYKEPGIFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVMSRVWDEGYPWDMLFITRFETFLKNTLPTVISNWWYMKQMNARFKHENYGLMPLNSTLRKEPVFNDELPACILCGIVTIKPNVKEFTEDSAIFEDGTVFKAIDYVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPPLEKPTLAVIGLVQSLGAAIPTTDLQSRWAVQVIKGTCPLPSVKDMMNDIDEKMGKKLKLFGKSDTIQTDYVVYMDELASFIGAKPNIPWLFLTDPKLALEVYFGPCTPYQFRLVGPGKWPGARNAILTQWDRLLKPMTTRVVGSPLKPCLFCNWFRPVLISVVSIAALIVLF
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service