Mediates cleavage of dimethlysulfonioproprionate (DMSP) into dimethyl sulfide (DMS) and acrylate. DMS is the principal form by which sulfur is transported from oceans to the atmosphere and is a key component of the ocean sulfur cycle.

Belongs to the aspartate/glutamate racemases family. ALMA1 subfamily.

383 amino acids

MGCAGSTLRSGASFEDSRLAAIEDSRFHEVGHHAQFEDSRLAAIEDSRFHEVGHHAQFDEGGRFKQLPPANDDAKLLVADHPSLGVIRLDYDYPPALGDVDHPGSFYYDVFYRVVPGLTFELCQSGELPDDVKQRFIDAITWLDEQGVAGITGDCGFFMYFQALARSVTSKPVFMSSLCQLPAVVCAYAADEHIALFTANGESLKPMRELIKKECGVDPDDTRFVIVGCEDVPGFEAVANGDRVDVDSVLPHLVRLAEDTVAKHAGTAKPIRAILFECTELPPYSDAVRAATRLPVFDSITCCNSMLASLMDNPRFGVNNWHLSWDGAHTAHRFGDNVPPHLKGKLVNREHPENVARWNASLAERSSFSSAQQESIGRGSREL

42.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ALMA6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here