Description
Mediates cleavage of dimethlysulfonioproprionate (DMSP) into dimethyl sulfide (DMS) and acrylate. DMS is the principal form by which sulfur is transported from oceans to the atmosphere and is a key component of the ocean sulfur cycle. Constitutes by far the most highly expressed Alma gene in CCMP373 strain.
Family
Belongs to the aspartate/glutamate racemases family. ALMA1 subfamily.
Sequence
MGNCTSHPHHEPQVHFDTVDGMATVKAFAGIRQVTMGVLRIDYEYQTNLGDILDPRSFDFRIISATAEGLTFAKAKAGDKLDATGKELLERAVRQLIDNGADFIVGDCGFLVYWQVMVRDYAQDYAQKKYGRKCPVMMSSLVLALPLLATIPSGGQIGILTASEKSLQAVQKKLPIVIEDHQKEDGGQRSRSVPAAEDPSGIMINFSDPRFKVVGLDEVKDFKHALDAQGADAVNDRRDIAVQIAAYCQKVQEKNPQIAAWLIECTEAGGFAWAIKVGTGLPVWDPITLGRFLSLGFTANVPNVALTLGQHGENPLDPSATTAGKGRCTGEEPGQIHALGAEFQAIREGTL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service