Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis (By similarity).

Belongs to the dihydrofolate reductase family.

185 amino acids

MTMIPDTELVLVVAADENNVIGLDGGVPWHYPEDVRQYKNRIAGHPIILGRRTFESMKPIPDCYTVVLTSDDRRSADSETVEYATTPQIAVEAAARAGASGAFAGDSAGADSSPPVTYVIGGEAVYDLFLPFAGRVFLSRIHEHNEGDRYFPDLGAEWTELSREPHDGFDVIEYEQASPRPLDDL

20.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make folA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here