Sugar octanoyltransferase likely involved in the biosynthesis of mycobacterial methylglucose lipopolysaccharide (MGLP). Catalyzes the transfer of an octanoyl group from octanoyl-CoA to the C6 OH of the second glucose in diglucosylglycerate (DGG). Can also use hexanoyl-CoA as acyl donor in vitro. DGG is the preferred acceptor, but to a lesser extent, GG (glucosylglycerate) can be used as substrate. DGG and GG are the two earliest intermediates in MGLP biosynthesis.

Belongs to the OctT acyltransferase family.

240 amino acids

MSGRRPTLLVFCDSLSYYGPRGGLPADDPRIWPNIVASQLDWDVELIGRVGWTSRDVWWAATQDPRAWAALPRAGAVIFATGGMDSLPSPLPTALRELIRYIRPPWLRRRVRDLYGWLQPRLSPVSRNALPPHLTAEYLEMTRGAIDFNRPGIPVVAALPSVHIADSYGRAHHGREATARAITEWARQHGVVLVDLKAAVADQVLNGRGNPDGIHWNFEAHQAVAELMLKALAEAGVPCR

26.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make octT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here