Description
Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). This reaction is the second ether-bond-formation step in the biosynthesis of archaeal membrane lipids. Cannot use other prenyl donors, i.e. farnesyl diphosphate (FPP) and phytyl diphosphate. Moreover, 4-hydroxybenzoate, 1,4-dihydroxy 2-naphthoate, homogentisate, and alpha-glycerophosphate do not function as prenyl acceptor substrates.
Family
Belongs to the UbiA prenyltransferase family. DGGGP synthase subfamily.
Species
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Sequence
MSLKSYMQLVRIHNVIGAALGAIMGFLVSSQWYLELKGILLSALVVGLIAAGGYVINDVYDVEIDKINKPYRPIPSGKISVNKAKALSIALFIIGIALSILLNIYALVIALVTAIGLIYYAKDLKKTGFYGNLLVATTTALSIFYGGLAFFSDNWLLRIIIPTLYAFFLTLIREIVKGIEDYNGDSLNNVKTLATTLGINKSWRIAKILLVLLLIISPLPFFIGFNLIYLILLILVFIPFTILSIIQKETIEGASKARTYLKISAISGIIAFLLGSLPFFKG
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service