Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). This reaction is the second ether-bond-formation step in the biosynthesis of archaeal membrane lipids.

Belongs to the UbiA prenyltransferase family. DGGGP synthase subfamily.

289 amino acids

MSAGIRTYLELMRYGNCLMAGFAAVIGTLIAFNILTSGPLSSNFTGPFPFLDAGFVFLVVFLVSGAGNAINDYFDIKIDSINRPERPIPSGRVQAKEALYFSYLLFAAGTLLAFSINSICGLIALFNSLLLILYAKTLKGTPLLGNLSIGYLTGSVFLFGASVFGLEGLKTLFVLFLLAALAITAREIVKDIEDMEGDRLEDADTLPLRIGAKKAGYLAVLIGLLAVLLSPLPCVMSILGLRYLYLVLLADLGFLAAIVQLLVKNNPTKSSKMFKIAMFFALIAFIAGV

31 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MA_0961 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here