Is involved in the reduction of 2,3-digeranylgeranylglycerophospholipids (unsaturated archaeols) into 2,3-diphytanylglycerophospholipids (saturated archaeols) in the biosynthesis of archaeal membrane lipids. Catalyzes the formation of archaetidic acid (2,3-di-O-phytanyl-sn-glyceryl phosphate) from 2,3-di-O-geranylgeranylglyceryl phosphate (DGGGP) via the hydrogenation of each double bond of the isoprenoid chains.

Belongs to the geranylgeranyl reductase family. DGGGPL reductase subfamily.

398 amino acids

MKNNYDILIIGGGPAGALAAKTAAEAGNTVCLIEKRAAIGTPVRCAEGIGKELLKEFIKPDPRWIAADIERARIISPNGTAISLEQDRAGNEVGYVLDRKIFDRELVWQAAEAGADVIVKTRATAPIMENGAVRGAKVLSVGIPADIRAEVVIAADGTEAQFARRAGLDTVVPLREMMSCAQYLMTDIDIDAGSTDFYLGNEIAPEGYLWVFPKGNRTANVGIGISGRKSRDGSRAKDYLDRFVAKNFPNGKTIEAIAGGVPVCRPLACTVADGLMVAGDAARVVDPITGGGIGNAMYTGRLAAQVASKCIAAGDCSKEALMPYDAEWRASKMGTVLERNYKVKEYFVTLDDAKLNTLAESIAQSSLKEFSVLGLIKELIKRNPKLLLELKALKDTLS

42.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Memar_0506 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here