Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule. PA is required for plant development and responses to abiotic stress and pathogen attack. May be involved in the accumulation of PA during cold stress (By similarity).

Belongs to the eukaryotic diacylglycerol kinase family.

509 amino acids

MEKYNSLSDFLKEFYIPTYVLSAETEEEEEEESRPTPASPVLVFINSKSGGQLGGELILTYRSLLNHNQVFDLDQETPDKVLRRIYLNLERLKDDDFARQIREKLKIIVAGGDGTAGWLLGVVCDLKLSHPPPIATVPLGTGNNLPFAFGWGKKNPGTDRTAVESFLEQVLKAKVMKIDNWHILMRMKTPKEGGSCDPVAPLELPHSLHAFHRVSPTDELNKEGCHTFRGGFWNYFSLGMDAQISYAFHSERKLHPEKFKNQLVNQSTYVKLGCTQGWFCASLFHPASRNIAQLAKVKIATRNGQWQDLHIPHSIRSIVCLNLPSFSGGLNPWGTPNPRKQRDRGLTPPFVDDGLIEVVGFRNAWHGLVLLAPNGHGTRLAQANRIRFEFHKGATDHTFMRMDGEPWKQPLPLDDETVMVEISHLGQVNMLATHDCRSRSVFDPSTPRHQDGAEDYDDNEDDSVAEGEEFRKFGAADTFKIPDEGEHSNKKGRASRRRNSNVHGWSHVL

57.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DGK5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here