Involved in triacylglycerol (TAG) synthesis. Catalyzes the acylation of the sn-3 hydroxy group of sn-1,2-diacylglycerol using acyl-CoA. Can use oleoyl-CoA and linoleoyl-CoA as substrates. May play a role in TAG biosynthesis in different tissues in responses to environmental and hormonal cues.

Belongs to the diacylglycerol acyltransferase family.

329 amino acids

MAAEPVSDGGAAAEKLISGREEFGDSSNLFSAILAMVLWLGAIHFNIALILLAVFFLPLSKSLLVFGFLFGFMVLPINEKSRFGRRLSRFICKHACNYFPITLHVEDMKAFDPNRAYVFGYEPHSVLPIGIVALADHTGFMPLPKVKVLASSTVFYTPFLRHLWTWLGLTPATKKNFISLLASGHSCILIPGGVQEAFHMQHGTEIAFLKARRGFVRVAMVKGKPLVPVFCFGQSNVYKWWKPGGKLFLKFARAIKFTPICFWGIFGSPLPFRHPMHVVVGRPIEVDKNREPTTEEVAKIHGLFVEALQDLFERHKARAGYPNLELRIV

36.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DGAT2D using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here