Deacylates the non-reducing end of diacetylchitobiose (GlcNAc2). Can also use N-acetylglucosamine (GlcNAc) and N-acetylchitotriose (GlcNAc3). Probably involved in chitin degradation.

Belongs to the PIGL family.

267 amino acids

MVFEEFNNFDEAFSALLSKLDFKINEPFNDVKKVLCIEPHPDDCAIGLGGTIKKLTDSGIDVVYLLLTDGSMGTTDGEVSGHELALRRLEEEKRSAEILGVKKIHALDFGDTELPYTREVRKEIVTVIRKERPGIVLMPDPWLPYEGHPDHRHAGFLGIEAVSFAGLPNFNRSDLIAGLDPHSIQAVGFYYTHKPNYFVDISDVMEVKLRAVRTHESQFPEDVWELWEPYLRTIALYYGKMSGHRYAEGIRFVPGIFLHICPFAHVI

30.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dac using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here