Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases (By similarity).

237 amino acids

MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED

26.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Diablo using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here