Has no detectable activity with D-mannonate and with a panel of 70 other acid sugars (in vitro), in spite of the conservation of the residues that are expected to be important for catalytic activity and cofactor binding. May have evolved a divergent function.

Belongs to the mandelate racemase/muconate lactonizing enzyme family. GalD subfamily.

409 amino acids

MKIIAADVFVTSPSRNFVTLRITTEDGVTGIGDATLNGRELAVAAYLKEHVAQLLIGKDPHRIEDTWQFLYRSSYWRRGPVTMAAIAAVDMALWDIKGKVAGMPVYQLLGGASRNGLRAYGHASGADIPSLFDSVREHLELGYKSIRIQTAVPGIKAVYGVAAQAQASGERYDYEPAGRGAFPVEEDWDTRAYLRHLPSVFEAVRNEFGPEIPLLHDGHHRMTPIQAAKLGKALEPYDLFWLEDCTPAENQEALRLVRQHTTTPLAIGEIFNTVYDYQTIIKEQLIDYVRAASTHFGGISPLKKVMDFAAQYQIKSGFHGPTDISPVGFAAQLHVGLAIHNYGIQEYMQHSDKTNEVFHQSMTFKDGYLHPGDEPGIGVEFNEEAAAAFPYQQAYLPYNRLVDGTVHDW

45.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Achl_0790 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here