About Products Protein Database Contact

Protein expression services for dbaC | Derivative of benzaldehyde biosynthesis cluster protein C

Description
Part of the gene cluster that mediates the biosynthesis of the antibiotic 2,4-dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA) and its derivatives (PubMed:22510154, PubMed:23001671). The direct non-reducing polyketide synthase dbaI product is 2,4-dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA), produced by condensation of one acetyl-CoA starter unit with 4 malonyl-CoA units and one methylation step (PubMed:22510154). The FAD-dependent monooxygenase dbaH is responsible for the synthesis of yellow pigments derived from the oxidation of DHMBA (PubMed:23001671). The roles of dbaB, C, E and F have still to be determined (Probable).
Family
Belongs to the YciI family.
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Length
98 amino acids
Sequence
MAQLYDWLVETPANAEDLESRINTRPAHLEHNKPLIEAGTLVWGGPSLAAHPKAAGEDLAIVGSVMCIRAGSEEEVREMIRNDPYAKLGQVSIRMSVK
Mass
10.7 kDa
Simulated SDS-PAGE
Western blot of dbaC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make dbaC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here