Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.

Belongs to the DeoC/FbaB aldolase family. DeoC type 1 subfamily.

217 amino acids

MSIAALIDHTLLAPDVTAQHIRTLCREAVDHGFATVCVSPTRVRLAADELAGHAPRVCSVIGFPSGAHLSEIRAAETKAAVNDGADEIDMVINVGAVKDDDWDTVESDISAVVDAAGMAIVKVILEVSELTDEEITRACQAAERCGADFVKTSTGYSRHGATAEAVSLMRRTVGDRLGVKASGGIRTHNDVATMLRAGATRIGASAGVALLVDEEAL

22.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make deoC1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here