Description
Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM.
Sequence
MDRTICPFFIQSFTMSTALKRLIPFLVPFVVFLVAAALGGLAADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKKVEEELSLLRRELYDRTDRPGLKRAVILSLATSAAIGGRMVSRTLRDNIPGYFVVINAILAAYYIRKVLTYRRRVMTKRQPFMSSVKNFFRRKPKDEGAGVDKASKKQT
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service