Catalyzes the reduction of Delta(1)-pyrroline-2-carboxylate (Pyr2C) to L-proline, using preferentially NADPH over NADH as the electron donor. Is likely involved in a degradation pathway that converts trans-3-hydroxy-L-proline (t3LHyp) to L-proline.

Belongs to the ornithine cyclodeaminase/mu-crystallin family.

325 amino acids

MLVISANEQRNLVNMNEVIAYAALALKEFSAERTITPIRGSLPFANEKNTALIMPSVAEGLEALGLKVVTVVPENKKIGKKTINGIVMLSDFQTGEPLALLEGSYLTMIRTGALSGVATKHLARHNAKTLCIIGTGEQAKGIAEAVFAVRDIEKVILYNRTEEKAYAFSQYIQEKFGKPAYVHTNANEAISEADIIVTTTNASTPVFSEKLQKGVHVNAVGSFKPSMQELPSHAIVGANKVVVESKEAALDETGDLQVPIKEGLFKANAIHAELGQIISGEKAGRENDEEITVFKSVGLAVVDIIVAKYLYEKAVESGVGNKIEF

35 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arcB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here