3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. Plays also a role in the biosynthesis of retinoic acid from retinaldehyde. Can utilize both NADH and NADPH.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

319 amino acids

MLFWLLVLLILCGFLWNYKRQLKIANITDKYIFITGCDTGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLHTVLLDVTDPENVKRAAQWVKNQVGEKGLWGLINNAGILGVLAPNDWLTVEDYREPVEVNLFGLISVTLNMLPLVKKARGRIINVSSIGGRLAFGGGGYSPSKYAVEGFNDSLRRDMKAFGVHVACIEPGLFKTNLSDPEKTAEKKLAIWKHLSPDIKQQYGESYIEKSLEQLKGTASFVNVDLSLVVECMDHALTSLFPKTRYAAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPRAV

35.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DHRS9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here