Catalyzes the sequential condensation of isopentenyl diphosphate (IPP) in the cis configuration with (2Z,6E)-farnesyl diphosphate (Z-FPP or EZ-FPP) generating the 50 carbon product trans,polycis-decaprenyl diphosphate. When (2E,6E)-farnesyl diphosphate (E-FPP or EE-FPP) is used in vitro, both primary products decaprenyl diphosphate and heptaprenyl diphosphate are synthesized. It is probably due to the fact that M.smegmatis synthesizes both (2E,6E,10E)-geranylgeranyl diphosphate (EEE-GGPP) and (2E,6E,10Z)-geranylgeranyl diphosphate (EEZ-GGPP). Can also accept many different allylic substrates, including E-geranyl diphosphate (E-GPP), neryl diphosphate (NPP), and all-trans-geranyl-geranyl diphosphate.

Belongs to the UPP synthase family.

293 amino acids

MATTRGKKTYPQLPPAPDDYPTFPDKSTWPVVFPEIPAGTNGRFARPPQHTSKAAAPKIPADQVPNHVAVVMDGNGRWATQRGLGRTEGHKMGEAVLIDITCGAIEIGIKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRENLNDMGVRMRWVGSRPRMWRSVIKEFDIAEQMTVDNDVITINYCVNYGGRTEIVEAARALAQEAVDGKINPARISEAMFAKHLHRADIPDVDLFIRTSGEQRASNFLLWQAAYAEYVFQDKLWPDYDRRDLWAACEEYVNRNRRFGRA

33.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make uppS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here